PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g051580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family SRS
Protein Properties Length: 201aa    MW: 23048.1 Da    PI: 9.4163
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g051580.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702197.15.5e-6161505154
          DUF702   5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskke 99 
                     + +C+dCGnqakk+C+++RCRtCCks++f+C+th+kstWvpa++r+++qq++++ + +    +++++ kr rel+    s+ ss++   +  +  
  Csa07g051580.1   6 GRRCEDCGNQAKKECVYMRCRTCCKSKAFHCQTHIKSTWVPAYRRSHHQQHQHQRQPQP-LFTTSSNIKRLRELQRLPDSSPSSSS---GV-QIR 95 
                     569********************************************999988876555.45677888899988555555555443...44.445 PP

          DUF702 100 letsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                     ++ +++P+e++ +a frcv+vss+ dg+e++aYqt+v+igGh+f+GiL+dqG+++
  Csa07g051580.1  96 TTPEHFPAELNFPADFRCVKVSSIHDGKEQYAYQTTVNIGGHIFRGILHDQGPDK 150
                     55677************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.8E-576149IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.3E-28950IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.1E-27100148IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MMMIMGRRCE DCGNQAKKEC VYMRCRTCCK SKAFHCQTHI KSTWVPAYRR SHHQQHQHQR  60
QPQPLFTTSS NIKRLRELQR LPDSSPSSSS GVQIRTTPEH FPAELNFPAD FRCVKVSSIH  120
DGKEQYAYQT TVNIGGHIFR GILHDQGPDK VMVDHHNNRN CNNRQETLLP PSTSSCPLMI  180
TSHFTDFMSG SNQYSSVLRR *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0068417e-83AC006841.7 Arabidopsis thaliana chromosome 2 clone F3K23 map mi148, complete sequence.
GenBankAY1637777e-83AY163777.1 Arabidopsis thaliana hypothetical protein (F3K23.16) mRNA, partial cds.
GenBankCP0026857e-83CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010416889.11e-151PREDICTED: protein SHI RELATED SEQUENCE 3-like
SwissprotQ9SJT83e-96SRS3_ARATH; Protein SHI RELATED SEQUENCE 3
TrEMBLR0HHW62e-93R0HHW6_9BRAS; Uncharacterized protein
STRINGAT2G21400.18e-94(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91882638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21400.15e-92SHI-related sequence3